PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa09g080030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family TALE
Protein Properties Length: 538aa    MW: 61548.7 Da    PI: 6.855
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa09g080030.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.71.1e-093804171954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+++e+  L+k++gL+++qV +WF N R +
  Csa09g080030.1 380 FEHflHPYPKESEKIMLSKQTGLSKNQVANWFINARVR 417
                     665559******************************88 PP

2BELL125.32.3e-40243314172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     erqelq+kk+kLl++++eVdkrY+qy++q+++++ssFe+v+glg+akpYts+Al++iSrhFrcL+dai+eqi
  Csa09g080030.1 243 ERQELQNKKSKLLTMVDEVDKRYNQYHHQMEALASSFEMVTGLGAAKPYTSVALNRISRHFRCLRDAIKEQI 314
                     79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.2E-51173312IPR006563POX domain
PfamPF075265.5E-48179310IPR006563POX domain
PROSITE profilePS5007112.066358421IPR001356Homeobox domain
CDDcd000866.33E-11361422No hitNo description
SMARTSM003891.9E-9361425IPR001356Homeobox domain
SuperFamilySSF466893.55E-17362428IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.9E-28364427IPR009057Homeodomain-like
PfamPF059201.8E-17378417IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 538 aa     Download sequence    Send to blast
MAVYYPNSVG MQSMYHESIY LNEQQQQQQQ QATSSSAASF SEIVSGDVRH NNEMVFIPPT  60
TSDVAVNGNV TVSSNDLSFH GGGLSLSLGN QIQSAVSVSP FQYHYQNLSN QLNYNNASTM  120
SPDENGKSLS GHHHHHHHHQ QQQHHSDQMI PSSGYNNNNN GVGFYNNYRY ETSGFVSSVL  180
RSRYLKPTQQ LLDEVVSVRK ELKLGNKKMK NNDKGQDFQN GSSDNNITED EKPQQSQELS  240
PSERQELQNK KSKLLTMVDE VDKRYNQYHH QMEALASSFE MVTGLGAAKP YTSVALNRIS  300
RHFRCLRDAI KEQIQVIRGK LGERETSDEQ GERIPRLRYL DQRLRQQRAL HQQLGMVRPA  360
WRPQRGLPEN SVSILRAWLF EHFLHPYPKE SEKIMLSKQT GLSKNQVANW FINARVRLWK  420
PMIEEMYKEE FGDSELETNS NQDNNKTQET SQLKHEESSS QQHNQGNINN NNIAYTSHGE  480
ENLVFADPKP DRATTGEYDS LMNYHGFGID DYNRYVGLGN QQDARFSNPH QLHDFVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B1e-15367425563Homeobox protein Meis2
3k2a_A1e-15367425563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3530930.0AF353093.1 Arabidopsis thaliana BEL1-like homeodomain 3 (BLH3) mRNA, complete cds.
GenBankAY0625450.0AY062545.1 Arabidopsis thaliana Similar to homeodomain proteins (At1g75410; F1B16.6) mRNA, complete cds.
GenBankAY0852780.0AY085278.1 Arabidopsis thaliana clone 142443 mRNA, complete sequence.
GenBankAY5984520.0AY598452.1 Arabidopsis thaliana BEL1-like homeodomain 3 protein mRNA, complete cds.
GenBankBT0001330.0BT000133.1 Arabidopsis thaliana Similar to homeodomain proteins (At1g75410) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010428562.10.0PREDICTED: BEL1-like homeodomain protein 3
SwissprotQ9FWS90.0BLH3_ARATH; BEL1-like homeodomain protein 3
TrEMBLR0IEB00.0R0IEB0_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.2__1821__AT1G75410.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.20.0BEL1-like homeodomain 3